PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe7G112900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family GRF
Protein Properties Length: 381aa    MW: 43870.3 Da    PI: 8.3817
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe7G112900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.66.1e-2572115144
                WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                        d+epgrCrRtDGKkWRCs+++++++k+CErH+hrgr+rsrk++e
  Aqcoe7G112900.1.p  72 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVE 115
                        79***************************************998 PP

2QLQ60.25.9e-211045237
                QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                       +FT +Q+q+L++Q+l+yKy+a+++P+Pp+L+++i++
  Aqcoe7G112900.1.p 10 PFTVTQWQELEHQALIYKYMASGMPIPPDLIFPIKR 45
                       9*********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.2E-12945IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.3381045IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.7E-151043IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.32572116IPR014977WRC domain
PfamPF088793.6E-2173115IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0030912Biological Processresponse to deep water
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MMMSARNRNP FTVTQWQELE HQALIYKYMA SGMPIPPDLI FPIKRSLDSS RFFPHQPMDW  60
GCFQMGYGRK VDPEPGRCRR TDGKKWRCSK EAYPDSKYCE RHMHRGRNRS RKPVEVNTTS  120
NSSLPLSSFT SRTPSSTITS NTNPSSYSLS SSLTSDKSQQ EHHHPYHNTP LHSFLNPSRT  180
SCSSPRTHNI DFSPHSNNNA NLVLDSGSYS NSYEDHRNRY VHGLKEEVDE RAFFSEASGT  240
LRSVPESTLK DPWRLTPLRM SSSTHNQPKD GNFSDLQRGY SQFQLQHKQQ QQQQEEEQHC  300
FILGTDFKSD RFMKTSTTTT EKEESQQPLR HFFDEWPPKS KDSWLGLEED RSDQGSHSTT  360
QLSISIPMSS HEFSVSNSRT *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150426e-54AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010273921.11e-145PREDICTED: growth-regulating factor 1 isoform X2
TrEMBLD7TCG21e-128D7TCG2_VITVI; Putative uncharacterized protein
STRINGVIT_11s0016g01250.t011e-127(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-59growth-regulating factor 5